CDS

Accession Number TCMCG047C11043
gbkey CDS
Protein Id GFP89608.1
Location 509181..509405
Organism Phtheirospermum japonicum
locus_tag PHJA_001104500

Protein

Length 74aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJDB3858 BioSample:SAMD00029051
db_source BMAC01000196.1
Definition 50S ribosomal protein l20 chloroplastic [Phtheirospermum japonicum]
Locus_tag PHJA_001104500

EGGNOG-MAPPER Annotation

COG_category J
Description Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit
KEGG_TC -
KEGG_Module M00178        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE br01610        [VIEW IN KEGG]
ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko03011        [VIEW IN KEGG]
KEGG_ko ko:K02887        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03010        [VIEW IN KEGG]
map03010        [VIEW IN KEGG]
GOs GO:0000027        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003735        [VIEW IN EMBL-EBI]
GO:0005198        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009526        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009941        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0022607        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0022618        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0034622        [VIEW IN EMBL-EBI]
GO:0042254        [VIEW IN EMBL-EBI]
GO:0042255        [VIEW IN EMBL-EBI]
GO:0042273        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043933        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0065003        [VIEW IN EMBL-EBI]
GO:0070925        [VIEW IN EMBL-EBI]
GO:0071826        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGATCATAATTAAATGCGAATATATAGCTCAGAGACGTAGAACAAAAATTTGTTTATTTGCATCAAGTTTTCGGGGGACTCATTCAAAACTTACTCGAACTATTATTCAACAGAAAATAAGAGCTTTGGTTTTGGCTCATCGGGATAAGGACAAGCAAAAGAGAAATTTTCGTCGTTTGTGCATCACTCAGATAAACGTAGTAATTCGAGAATCTAGACAATAA
Protein:  
MIIIKCEYIAQRRRTKICLFASSFRGTHSKLTRTIIQQKIRALVLAHRDKDKQKRNFRRLCITQINVVIRESRQ